PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT12754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MIKC_MADS
Protein Properties Length: 312aa    MW: 34689.9 Da    PI: 10.0307
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT12754genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.11.5e-30959151
              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
              krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  EMT12754  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
              79***********************************************95 PP

2K-box95.96.3e-321442359100
     K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                e + ++++qqe+akL+ +i++Lq++++hl+G+++++LslkeL+qLe++Lek++ kiR++Knell ++i+++ k+e elq++  +Lr+k++e
  EMT12754 144 IEVNAQQYYQQEAAKLRHQIQMLQSTNKHLVGDSVGNLSLKELKQLESRLEKGIAKIRARKNELLSSEINYMVKREIELQSDSIDLRTKIAE 235
               5667899**********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.389161IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.42E-29262IPR002100Transcription factor, MADS-box
CDDcd002652.01E-38260No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-32323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004049.4E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-23146233IPR002487Transcription factor, K-box
PROSITE profilePS5129713.878149239IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGRGRIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
RAVSQLGLGL AADCFCARRA SLTRGRARAS PPQPRPPLRV LQQQVTDVSL PVSPPLFINC  120
SVKATIDRYK KAHACGSTSG VPLIEVNAQQ YYQQEAAKLR HQIQMLQSTN KHLVGDSVGN  180
LSLKELKQLE SRLEKGIAKI RARKNELLSS EINYMVKREI ELQSDSIDLR TKIAEEEQRL  240
QQVTIARPSV APELNPFTAL DMKCFFPANL FEAAVHAHAQ AQAQAQAQAS LQLNLGYQQL  300
APPGAGDVAH QF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-17159159Myocyte-specific enhancer factor 2B
1tqe_Q3e-17159159Myocyte-specific enhancer factor 2B
1tqe_R3e-17159159Myocyte-specific enhancer factor 2B
1tqe_S3e-17159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00093SELEXTransfer from AT3G58780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ5123490.0DQ512349.1 Triticum aestivum MADS-box transcription factor TaAGL31 (AGL31) mRNA, complete cds.
GenBankDQ5123640.0DQ512364.1 Triticum aestivum MADS-box transcription factor TaAGL9 (AGL9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578791.11e-108PREDICTED: uncharacterized protein LOC100836399 isoform X2
SwissprotQ2QW531e-86MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLN1QX580.0N1QX58_AEGTA; MADS-box transcription factor 13
STRINGMLOC_57890.11e-112(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.31e-72MIKC_MADS family protein